PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011085629.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family M-type_MADS
Protein Properties Length: 193aa    MW: 22270.9 Da    PI: 9.8766
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011085629.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF38.71.3e-121555242
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                    +i+n+++r+v   kR + + KKA+ELS+LC++++ ++i  +
  XP_011085629.1 15 QISNETKRKVLCMKRVESLTKKASELSILCGVNIGIVIHEP 55
                    69**********************************99765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006614.101652IPR002100Transcription factor, MADS-box
SMARTSM004328.8E-10665IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.58E-19799IPR002100Transcription factor, MADS-box
CDDcd002668.33E-18790No hitNo description
PRINTSPR004049.3E-5828IPR002100Transcription factor, MADS-box
PfamPF003191.3E-131656IPR002100Transcription factor, MADS-box
PRINTSPR004049.3E-52843IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 193 aa     Download sequence    Send to blast
MENMYMTRKR VKHGQISNET KRKVLCMKRV ESLTKKASEL SILCGVNIGI VIHEPTENNA  60
ILWPSPEVFG DRLQKFLDFS GSERAKKMMN HEKYLHQRVH DGIEEMSKSQ YRKEFKESQL  120
LMNELLIKGK DFSAVDLVQL SCLRSLAAQM LKKLQFRNDE LNGQERQMLT PPLPPSPLSM  180
PTSHTIVSNK DQV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011085629.11e-143PREDICTED: agamous-like MADS-box protein AGL80
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA37820129
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26630.18e-18M-type_MADS family protein